SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019850 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019850
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily Immunoglobulin 6.63e-34
Family V set domains (antibody variable domain-like) 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019850   Gene: ENSAMEG00000018799   Transcript: ENSAMET00000020619
Sequence length 97
Comment pep:novel scaffold:ailMel1:GL196287.1:5143:5433:1 gene:ENSAMEG00000018799 transcript:ENSAMET00000020619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSELTQPPFVSVTLGQTATITCSGEELEDFYVQWYQQKPGQAPVLVIYEDSDGPSGLLDR
FSGSRSGNTANLTISGAQAEDEADYYCQTYDSSADAH
Download sequence
Identical sequences G1MKG5
ENSAMEP00000019850 ENSAMEP00000019850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]