SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000049 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000049
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 1.1e-34
Family Sedlin (SEDL) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000000049
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000844
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000049   Gene: ENSAMEG00000000048   Transcript: ENSAMET00000000051
Sequence length 219
Comment pep:novel scaffold:ailMel1:GL194256.1:168894:171264:-1 gene:ENSAMEG00000000048 transcript:ENSAMET00000000051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGVDVNGKYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Download sequence
Identical sequences A0A212DHN7 D2I333 F7BPJ2 L8IFV0 M3VW28 M3Y0U2 Q2TBL9 S9YVG4 W5PSI4
ENSFCAP00000001067 ENSMPUP00000004943 ENSBTAP00000010619 ENSAMEP00000000049 ENSECAP00000004298 ENSECAP00000004298 ENSMPUP00000004943 9685.ENSFCAP00000001067 9796.ENSECAP00000004298 9823.ENSSSCP00000016027 9913.ENSBTAP00000010619 9913.ENSBTAP00000044469 ENSFCAP00000001067 ENSSSCP00000016027 ENSOARP00000013413 ENSBTAP00000010619 NP_001178133.1.59421 NP_001178133.1.76553 XP_001503119.1.31192 XP_002929644.1.58354 XP_003992476.1.62641 XP_004016136.1.66739 XP_004412666.1.74151 XP_004667440.1.11716 XP_004750038.1.14098 XP_005689583.1.57651 XP_005897193.1.15283 XP_005955157.1.78601 XP_006078724.1.26621 XP_006175368.1.101512 XP_006207808.1.17985 XP_006749251.1.47382 XP_007072969.1.5354 XP_010951742.1.22495 XP_010979661.1.51371 XP_011973175.1.54773 XP_014711145.1.49734 XP_014937545.1.86478 XP_017505742.1.32401 XP_019324493.1.44245 XP_019830744.1.53367 XP_020727685.1.74333 XP_021552028.1.83697 ENSVPAP00000000246 ENSAMEP00000000049 ENSVPAP00000000246 ENSSSCP00000016027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]