SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000220 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000220
Domain Number 1 Region: 418-702
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-78
Family Protein kinases, catalytic subunit 0.0000000399
Further Details:      
 
Domain Number 2 Region: 867-1008
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.62e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-42
Family Second domain of FERM 0.0000196
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-33
Family First domain of FERM 0.00039
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-30
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000220   Gene: ENSAMEG00000000174   Transcript: ENSAMET00000000226
Sequence length 1011
Comment pep:novel scaffold:ailMel1:GL192389.1:811471:869283:-1 gene:ENSAMEG00000000174 transcript:ENSAMET00000000226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPDPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQDVIASILMSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVLKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIHPKKDGEKRNSLPQIPVLNLEAQRPHLSESCSIESDIYAEIPDETLRRPGGPQYGI
TREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFLSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASTECVKLGDFGLSRYIEDEEYYKAKASVTRLPIKWMSPESIN
FRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLM
TRCWDYDPSERPRFTELVCNLSDIYQMEKDITIEQERNARYRPPKILEPTAYQEPPPKPS
RPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHS
MREEDFIRPSSREEAQQLWEAERLKMRQILDRQQKQMVEDYQWLRQEEKSLDPMVYMNDK
SPLTPEKEAGYTEFTGPPQKPPRLATQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNEL
CQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMR
LAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences G1L018
ENSAMEP00000000220 ENSAMEP00000000220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]