SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001542 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001542
Domain Number 1 Region: 874-1168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.94e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000117
Further Details:      
 
Domain Number 2 Region: 213-357
Classification Level Classification E-value
Superfamily PH domain-like 4e-35
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 105-211
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-29
Family Second domain of FERM 0.00038
Further Details:      
 
Domain Number 4 Region: 19-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-18
Family First domain of FERM 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001542   Gene: ENSAMEG00000001393   Transcript: ENSAMET00000001601
Sequence length 1172
Comment pep:novel scaffold:ailMel1:GL192709.1:315136:381622:-1 gene:ENSAMEG00000001393 transcript:ENSAMET00000001601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELREIT
YFSLWYHNKQNQRRWVDLEKPLKKQLDKYASEPTVYFGVVFYVPSVSQLQQEITRYQYYL
QLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKVLE
EATQKVAVLHQKYRRLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGIF
VKHKNGRPPVIFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVARHK
FYRLNQCSLQTQTVTVNPIRRRSSSRVSLPKPQPYVMPPPPQLHYNGHYTEPYTSSQDNL
FATNQNGYYCHSLTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPSIT
GSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMVHAERQSHSLRNLNIGNSYA
YSRPDALVYSQPEIREHAHFASPQSAHYPFSLNYSFHSPSPYPHPAERRLVVGAVSVPEL
TNVQLQAQDYPAPNIMRTQVPYPPPRPANSTPDLSRHLYISSSNPDLITRRVHHSVQTFQ
EASLPVAHSLQEVSEPLTAARRAHLHKRNSIEVAGLAHSLEGLRLKERTPRRPPTRCPGP
SRRAPSLVASPKGPSYGHKKSLSTMLIHSSEDEEDLEEEIASLAVPLPPRPARASSTAAS
LRPRSGRPSGLAERGFSRPKKSGLIGVLLQQANQFPPAYGAAGPPGCVLQQNRDSAAEKA
RSLLPKSRMLSAWSLTSHYNRDLKRIAFHNLLSARLIRALALKRMSSSQCLLNKRGMKKS
RVDAKKIGPLKLAALNGLSLSRLPLPDEGKEVPARATNDERCRILEQRLEQGMVFTEYEK
ILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSVSG
IEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTVEEEGGREKSFRYWPRLGSRHNTVT
YGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYLE
EIQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDVPRVLGM
LRQQRMAMVQTLCQYTFVYRVLVQFLKSSRLI
Download sequence
Identical sequences G1L3T2
ENSAMEP00000001542 ENSAMEP00000001542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]