SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001694 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001694
Domain Number 1 Region: 218-480
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-74
Family Protein kinases, catalytic subunit 0.000000227
Further Details:      
 
Domain Number 2 Region: 128-260
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-34
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 56-176
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000147
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001694   Gene: ENSAMEG00000001582   Transcript: ENSAMET00000001760
Sequence length 494
Comment pep:novel scaffold:ailMel1:GL193319.1:193049:200065:-1 gene:ENSAMEG00000001582 transcript:ENSAMET00000001760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLRDPGFGVVTPGSMEPFLRKRLTFLSFFWDKIWPVAGVPGFPDPAASAEPAPSAPEPC
GAPAPAQLFRALYDFTARCSAELSVSRGDRLYALKEEGDYIFARRLSGPPSTGLVPITHL
AKATPESLSDYPWYFSDISRAQAQQLLLSTANAPGAFLIRPSESSHGDYTLSVRAQATVH
HYRIATAADGLYLQKSQLFPSLQELLAYYKANWKLIRNPLLQPCVPQLPQQDKWERPRSE
FALRRKLGEGYFGEVWEGLWLGSTPVAVKVIKSAYMKLADLSKEIQTLKSLRHERLIRLH
AVCSAGRPVYIVTELMRKGNLQAFLGSPEGRALGLPLLLSFACQVAEGMSYLEERRIVHR
DLAARNVLVGDDLACKVADFGLARLLKDDVYSPSSGSKIPVKWTAPEAATYHIYSPKSDV
WSFGVLLYEVFTYGQCPYEGLSNHETLPCPASCPAEVYTLMLECWRDSPEERPTFPALQE
RLNAAHRRLAPART
Download sequence
Identical sequences G1L484
ENSAMEP00000001694 ENSAMEP00000001694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]