SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001862 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001862
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-79
Family Protein kinases, catalytic subunit 0.00000000143
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-37
Family SH2 domain 0.00000891
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily SH3-domain 2.27e-21
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001862   Gene: ENSAMEG00000001737   Transcript: ENSAMET00000001938
Sequence length 512
Comment pep:novel scaffold:ailMel1:GL193103.1:34022:98562:-1 gene:ENSAMEG00000001737 transcript:ENSAMET00000001938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKDNLNDDGIDLKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEELGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRDSIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences G1L4Q2
ENSAMEP00000001862 ENSAMEP00000001862 XP_002924155.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]