SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002248 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002248
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 228-369
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000248
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002248   Gene: ENSAMEG00000002118   Transcript: ENSAMET00000002341
Sequence length 622
Comment pep:novel scaffold:ailMel1:GL193441.1:524066:556932:-1 gene:ENSAMEG00000002118 transcript:ENSAMET00000002341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPVRSRHLLQLLSDSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDSLDLDVD
QLEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDGYSGSAIHRK
LKTCSSMTSHGSSHTSGVESSGKDRLEEDSQDDEIEMLVDDPRDLEHMNEESLDVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHNLDEEGLYCNSCLAQQCVNIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences D2HV46
ENSAMEP00000002248 ENSAMEP00000002248 XP_002926540.1.58354 XP_019662792.1.58354 XP_019662793.1.58354 XP_019662794.1.58354 XP_019662795.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]