SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003365 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003365
Domain Number 1 Region: 253-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.0000000134
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-34
Family SH2 domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 57-139
Classification Level Classification E-value
Superfamily SH3-domain 3.26e-17
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003365   Gene: ENSAMEG00000003170   Transcript: ENSAMET00000003500
Sequence length 527
Comment pep:novel scaffold:ailMel1:GL192508.1:638902:677227:1 gene:ENSAMEG00000003170 transcript:ENSAMET00000003500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICFSDNTIQSIFCCCCCCSLQKRQVRTQISLSKDEEFSEKYPQRRRLWSRELPSKKQSN
RDHVQPSKRKPLPPLPPSEVTEEKIQVKALYDFLPREPCDLALKRSEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKLTNLEIYEWYHRNITRNQAERILRQESKEGAFIVRDSRH
LGSYTISVFIKARRNMEATIKHYQIKKNDSGQWYVAERHLFQSIPDLIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPAELAFVKEIGSGQFGVVHLGEWRAHIRVAIKA
ISEGSMSEEDFIEEAKVMMKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLSYLRDRRG
SLSREGLLSMCQDVCEGMEYLERNCFIHRDLAARNCLVNAASIVKISDFGMTRYVLDDEY
ISSSGAKFPIKWSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
QGFRLYRPQLAPMSIYEVMYSCWHEKPKGRPTFAELLQVLTEIAETW
Download sequence
Identical sequences G1L8Z6
XP_002917054.1.58354 ENSAMEP00000003365 ENSAMEP00000003365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]