SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004015 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004015
Domain Number 1 Region: 218-362
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-39
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-31
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.1e-27
Family First domain of FERM 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004015   Gene: ENSAMEG00000003807   Transcript: ENSAMET00000004178
Sequence length 399
Comment pep:novel scaffold:ailMel1:GL192411.1:45875:276690:-1 gene:ENSAMEG00000003807 transcript:ENSAMET00000004178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAFCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSISKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDKHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLIKWPDVYKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPVVHRANM
TQSRSSYSLNKQLIINMEPLQPLLPCPSEQEEELPLGEG
Download sequence
Identical sequences G1LAU2
ENSAMEP00000004015 ENSAMEP00000004015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]