SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005823 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005823
Domain Number 1 Region: 1124-1300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 452-574
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-25
Family Pleckstrin-homology domain (PH domain) 0.0000136
Further Details:      
 
Domain Number 4 Region: 921-1034
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1435-1568
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-18
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000159
Family SAM (sterile alpha motif) domain 0.0000547
Further Details:      
 
Domain Number 7 Region: 585-685
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000161
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 8 Region: 1016-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000123
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005823   Gene: ENSAMEG00000005492   Transcript: ENSAMET00000006067
Sequence length 1708
Comment pep:novel scaffold:ailMel1:GL193999.1:13509:190120:-1 gene:ENSAMEG00000005492 transcript:ENSAMET00000006067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLRFREFGLNTVKDCVAVNDGVLHKIGISPTGHRRRI
LKQLQIILSKMQDVPIYANIHKTKKDDDTSEDRHTPSSGWNTCAERSDTGGVQAPSLTQW
ETVTKNLDQNDVSVENSQSLKSDDKLSLLKHNFPVPEEPHLNLSSFQHSLFGNENIKTES
LISEKTTDCTFEEQPTERSDLISENGSKLPDIDPECLSSLGCSVSEANSGNATNGLTERS
PPSPFFQFQGEMVVNELYVPSSPILAPMRSCSKWVSRPSQSFLLRHRPVPEIPGSTKGIL
GSYFRERRNVATSTGKSVTQENSNEENSSSIFPYGETFLLQRLENSKKRSIKNEFWTHEE
TLKGETTTERNSFLIKSSIYDNRKENITEDKVEDIWIPREDKNNFPIDSASESEYSTVEE
CFQSLRRKNSKASKSRTQKALTVDPVNRHSHPLSSTSGNAESSIVSSNAISPYACFYGPS
TRKVKSGWLDKLSPQGKRMFQKRWVKFDGLCISYYNNEKEKYSKGIIPLSAISTVRVQGD
NKFEVVTTQRAFVFRVEKEEERNDWISILLNALKTQSPALQSQAAAAPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPRDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVMKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLSQEASQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKED
FYLNTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQ
LYYKDCHALDQWRKGWFSLEKSSLRFCLQMQEVQEDRMHLRRLQELTISTVVQNGEKMDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKYFLSDIDNAL
LTKELYPYWISALDIQDDKERIKKYGAFIRTLPGVNRATLAAVIEHLYRVQKCSEINHMN
AHNLALVFASCLFQTKGQTSEEVNVIEDLINNYVEIFEVEEDQVKQMDIENSFITKWKDT
RVSQAGDLLIEVYVERKEPDCSIIIRISPVTEAEELTSDVLAIKNIIPTKGDIWATFEVI
ENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTIKHYNERRALGSIKEGV
LKIKEEPSKILSGNKFQDRYFVLRDGYLFLYKDSKSSKYDKMFSLGSMKFYLGVKKKMKP
PTSWGLTAYSEKHHWHICCDSPQTQMEWMANVFIAQHENDIWPPAGKERKRSITKNPKIG
GLPLIPIQHERSGTQARRNIESARAELERLRLSEKRDQELGESSLKERASMVAQCLEHKD
EKLRTRTRKHQSLNCLEDTEAEVLHGPQKSHKGLKTLRKTEDRNGKVALDSGSKLPSRVI
EELSMVLQRTRTVPKDLEDEQILQKEIK
Download sequence
Identical sequences G1LFY4
ENSAMEP00000005823 ENSAMEP00000005823 XP_002929056.1.58354 XP_011235285.1.58354 XP_019665262.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]