SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006125 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006125
Domain Number 1 Region: 318-611
Classification Level Classification E-value
Superfamily Kelch motif 6.8e-71
Family Kelch motif 0.0000599
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 1.31e-25
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006125   Gene: ENSAMEG00000005814   Transcript: ENSAMET00000006376
Sequence length 634
Comment pep:novel scaffold:ailMel1:GL192980.1:747169:750824:-1 gene:ENSAMEG00000005814 transcript:ENSAMET00000006376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKTVRKSKGDINEMTIIVEDCPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLL
EGLSKMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSTQRVDLNDISPLG
LATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYIANIAE
TYSLKNAKAAAQKFIRDNFLEFAESDQFLKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLANMNQKRTHFSLSVFNGL
LYAVGGRNTEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVTDGRVLVTGGYIGSAYS
RSVCAYDPTSDSWQELPGLSTPRGWHCAVTLGDRVYVMGGSQLGPRGERVDVLTVECYSP
ATGQWSYAAPLLVGVSTAGASALHGRAYLLGGWNEGEKKYKKCIQCFSPELNEWTEDDEL
PEATVGVSCCTLSMPNSVTRESRASSVSSVPVSI
Download sequence
Identical sequences D2HKW6
ENSAMEP00000006125 XP_002923002.1.58354 XP_011227873.1.58354 ENSAMEP00000006125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]