SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007077 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007077
Domain Number 1 Region: 37-114
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.58e-29
Family Hormone receptor domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 86-379
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000119
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007077   Gene: ENSAMEG00000006692   Transcript: ENSAMET00000007377
Sequence length 412
Comment pep:novel scaffold:ailMel1:GL192662.1:570871:599953:-1 gene:ENSAMEG00000006692 transcript:ENSAMET00000007377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTALLYGLLEANCSLALVEELLLDGWGLPPDPEGSPYSYCNTTLDQIGTCWPRSAAGAL
VERPCPEYFNGVKYNTTRNAYRECLENGTWASRINYSQCEPILDDKQRKYDLHYRIALVV
NYLGHCVSVAALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNVVWFLLQLIDHEVHES
NEVWCRCVTTIFNYFVVTNFFWMFVEGCYLHTAVVMTYSTERLRKWLFLFIGWCIPCPII
IAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTT
SETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFY
CFFNGEVRSAVRKRWHRWQDHHSLRVPVARAMSIPTSPTRISFHSIKQTAAL
Download sequence
Identical sequences G1LJH2
ENSAMEP00000007077 ENSAMEP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]