SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008050 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008050
Domain Number 1 Region: 265-521
Classification Level Classification E-value
Superfamily Kelch motif 1.27e-32
Family Kelch motif 0.0048
Further Details:      
 
Domain Number 2 Region: 57-164
Classification Level Classification E-value
Superfamily POZ domain 1.13e-31
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008050   Gene: ENSAMEG00000007634   Transcript: ENSAMET00000008383
Sequence length 543
Comment pep:novel scaffold:ailMel1:GL192844.1:1169508:1172973:-1 gene:ENSAMEG00000007634 transcript:ENSAMET00000008383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRLWIPHYSGWCCFADRWQREKLATMESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIM
KLCLEEELFADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESV
FQLLVDYIYHGTVKLRAEELQEIYEVSDMYQLTSLFEECSRFLARTVQVGDCLQVMWLAD
RHSDPELYTAAKHCAKAHLAQLQSTDEFLHLPHHLLTDIISDGVPCSQNPTEAIEAWINF
NKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCH
QITAACKHGGDLYVVGGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSL
GGKTLQDTLSNAVIYYRVGDNVWTETTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTK
PSRLIQCFDTETDKCHVKPYVLPFAGRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLC
LPEAWSSAPSLWKIASCNGSIYVFRDRYKKGDANTYKLDPATSAVTVTRGIKVLLTNLQF
VLA
Download sequence
Identical sequences G1LM68
ENSAMEP00000008050 ENSAMEP00000008050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]