SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008151 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008151
Domain Number 1 Region: 232-332,364-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.16e-74
Family Protein kinases, catalytic subunit 0.000000000506
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-39
Family SH2 domain 0.00000114
Further Details:      
 
Domain Number 3 Region: 52-172
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-23
Family SH3-domain 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008151   Gene: ENSAMEG00000007672   Transcript: ENSAMET00000008491
Sequence length 539
Comment pep:novel scaffold:ailMel1:GL192870.1:982327:990869:-1 gene:ENSAMEG00000007672 transcript:ENSAMET00000008491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLPIRNGSDVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENILLLDSQFGEKGLGVFCWGNLSQQLPLLLTGSLVDFLKT
PPGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE
DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVI
QNLERGYRMVRPDNCPEELYHLMMLCWKERPEERPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences G1LMD8
ENSAMEP00000008151 ENSAMEP00000008151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]