SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008946 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008946
Domain Number 1 Region: 13-134
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.53e-28
Family Hormone receptor domain 0.00014
Further Details:      
 
Domain Number 2 Region: 121-403
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000128
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008946   Gene: ENSAMEG00000008448   Transcript: ENSAMET00000009329
Sequence length 438
Comment pep:novel scaffold:ailMel1:GL193037.1:822702:889122:-1 gene:ENSAMEG00000008448 transcript:ENSAMET00000009329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAAKLVPTTYNVLYLDQVNSVHPECRFHLEIQEEETKCAELLRTQTEKYKACTGVWDNIT
CWRPADVGETVTVPCPKVFSNFYSKPGNISKNCTSDGWSEMFPDFIDACGYNGAEDESKI
AFYILVKAIYTLGYSVSLVSLTTGSIILCLFRKLHCTRNYIHLNLFVSFILRAISVLIKD
DVLYSRSGTLHCPDQPSSWVGCKASLVFFQYCIMANFFWLLAEGLYLHTLLVAIFSPSRR
FAAYLLIGWGIPTVCIGAWTAARLSLEDTGCWDTNDHSVPWWVIRAPILISIIVNFVLFV
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYVVFAVFPIGISSKYQILFE
LCIGSFQGLVVAVLYCFLNSEVQSELKRKWRSLCPSRPCGQDYRLHSSSVSRNGSESALQ
FHRGSRAPSLLQTETSVI
Download sequence
Identical sequences G1LPG6
ENSAMEP00000008946 ENSAMEP00000008946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]