SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009025 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009025
Domain Number 1 Region: 19-149
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.35e-26
Family Hormone receptor domain 0.00037
Further Details:      
 
Domain Number 2 Region: 138-410
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000824
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009025   Gene: ENSAMEG00000008518   Transcript: ENSAMET00000009410
Sequence length 450
Comment pep:novel scaffold:ailMel1:GL192545.1:631948:684444:-1 gene:ENSAMEG00000008518 transcript:ENSAMET00000009410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRAGSPNNGYTLREAACFNIRVGALPGLCDVLRVLREERDQCLQELSKEKPEDLGTEK
PAPGCEGLWDNMSCWPSSALGLTVEVGCPQFLQILTGRNGSMFRNCTQDGWSETFPRADL
ACGVNVNDSSNEKRHEYLMKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHL
FVSFILRALSNFIKDAVLFSSDDVAHCDAHRVGCKLVMAFFQYCIMANYAWLLVEGLYLH
TLLVISFFSERKCLQGFVALGWGSPAIFVASWAISRHFLEDVGCWDINANASIWWVIRGP
VILSILINFILFINILRILMRKLRTQETRGNEVNHYKRLAKSTLLLIPLFGVHYIVFAFS
PEDAIEVQWFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWRQWHLRESLLRPVALSSS
SFSNGTSGLAHSTKASTLEPSRATYRASVI
Download sequence
Identical sequences G1LPP5
ENSAMEP00000009025 ENSAMEP00000009025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]