SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009126 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009126
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-39
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-36
Family Second domain of FERM 0.0000673
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009126   Gene: ENSAMEG00000008640   Transcript: ENSAMET00000009516
Sequence length 732
Comment pep:novel scaffold:ailMel1:GL192545.1:1139067:1266409:1 gene:ENSAMEG00000008640 transcript:ENSAMET00000009516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKASTAKPEELSVHNNVSTQSNGSQQGCGVKSTVPVIPS
VPSGPVLAEIENLPRSPGLDQHDRKCLPLNIDLLDSPDLLETTIDDVIGTPDTLEVPQPP
DEVNIVTRQTGLEGTKEECGTLKDASQKLKHLQMESGPLPSSRPNIDVNINSQEEVVKLT
EKCLNNAIESPGLNARRVPPDLKSNILKAQVEAVHKVTREDSLLSHKNASVQVAATNSAV
LNENNVPFPEDSLALMHTTPAANGSVLKDATDELDALLLSLTENLMDHTVTPQVSSTSMI
TPRWIVPQSSVLSNGLAGSGPSLAGKEGHGSREVISLISPPAPFLVDAVTSSVPTLAEET
VLKQKCLLTTEL
Download sequence
Identical sequences G1LPZ6
ENSAMEP00000009126 ENSAMEP00000009126 XP_002917615.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]