SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009986 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009986
Domain Number 1 Region: 109-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-29
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 218-344
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-19
Family Third domain of FERM 0.006
Further Details:      
 
Domain Number 3 Region: 28-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000455
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009986   Gene: ENSAMEG00000009505   Transcript: ENSAMET00000010422
Sequence length 445
Comment pep:novel scaffold:ailMel1:GL192619.1:1573364:1582473:-1 gene:ENSAMEG00000009505 transcript:ENSAMET00000010422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWELGASRVMGGRRSLRLCTPSPGPEPPHVLQVQATGRELFQQVCDMASLRDAHFFGLSV
VRNDEYVFMDLGQKLSGYFSKDWKQEGRKGSGRPRAPFVTFLRVQFYVEDGRLLSDRTAR
HLYYCHLKERVLRSQCAHREEAYFLLAAYGLQADLGNHREPVHVGRYFEPHAYFPPWIVA
RRGSAYILRHAPAVHREQRGLSPTEAVLRFIREACRLEDVPVHFFKLYKDKKDDRPTVIL
GLTLNGMQIYQETSHAPELLYDFPWSHIGKVVFLGKKFEVQPDGLPSARKLVFYTGCAWR
SRHLSSHQLRLVLQPALRRLRQREEAEEKKHYRESYISDTLDLDLDPGGRGSPGSPHSGG
SRDSGGSSQHLPHRLSVRSADSHGSSHTSGIEADARPLEPGEMSVDAALGAEAPRAEAPA
CSSSTSQSSHCTDGGSGDRPEGDTQ
Download sequence
Identical sequences G1LSE6
ENSAMEP00000009986 ENSAMEP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]