SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010566 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010566
Domain Number 1 Region: 264-351,559-596
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.31e-45
Family Inhibitor of apoptosis (IAP) repeat 0.00000241
Further Details:      
 
Domain Number 2 Region: 177-252
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.09e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000929
Further Details:      
 
Domain Number 3 Region: 39-116
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.28e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 456-553
Classification Level Classification E-value
Superfamily DEATH domain 1.13e-22
Family Caspase recruitment domain, CARD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010566   Gene: ENSAMEG00000010065   Transcript: ENSAMET00000011023
Sequence length 621
Comment pep:novel scaffold:ailMel1:GL192883.1:502403:525373:1 gene:ENSAMEG00000010065 transcript:ENSAMET00000011023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKTTSRRLIPGSSCQRIKSTMEDSTILSNQTIGSKQKIKYDFSCELYRMSTYSTFPTGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKPGDNPVEKHKQLYPSCSFIHSLVALT
SRDSTFKNTSPMRNSFTHSLSPSLEHGGSFSGSHSNLAPNPVNPRAVEDFSPLRTNPYSY
AMSTEEARFLTYHMWPLTFLSPSDLARAGFYYIGPGDKVACFACGGTLSNWEPKDDAMSE
HRRHFPNCPFLENSLETLRFSISNLSMQTHAARLRTFVYWPSSVPVRPEQLASAGFYYVG
RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQDFVDEIQARHPHLLEQL
LSTSDAPGDENADPPSMFVHFGPGESPSEDAVMMNTPVVTAALEMGFSRSLVRQTVQSKI
LTTGENYRTVSDIVLALLNAEDETREEEKERQAEEMASDDLSLIRRNRMALFQQLTCVLP
ILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAASIFKSCLKEIDSTLYK
NLFVDKNMKYIPAEDVSGLSLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAP
SLRKCPICRGIIKGTVRTFLS
Download sequence
Identical sequences G1LU18
ENSAMEP00000010566 ENSAMEP00000010566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]