SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010610 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010610
Domain Number 1 Region: 237-389
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-32
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 127-235
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-22
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 41-127
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-20
Family First domain of FERM 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010610   Gene: ENSAMEG00000010064   Transcript: ENSAMET00000011069
Sequence length 1019
Comment pep:novel scaffold:ailMel1:GL193144.1:125216:289029:1 gene:ENSAMEG00000010064 transcript:ENSAMET00000011069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLRDVYQMTEGRHCQVHLLDDRRLELLVQ
PKLLSRELLDLVASHFNLKEKEYFGITFTDDTGQQNWLQLDHRVLDHDLPKKPGATTLHF
AVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIEADSETIFKLAALVLQEAKGDYTSDD
NARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQAVVQYMKIVEALPTYG
VHYYAVKDKQGLPWWLGISYKGIGQYDLQDKVKPRKLFQWKQLENLYFREKKFAVEVHDP
RRISVSRRTFGQSGLFVQTWYANPSLIKSIWVMAISQHQFYLDRKQSKAKIPSARSLDDI
AMDLTETGTPRVSKMVTLEAKSQFIMASNGSLISSGSQDSEVSEEQKREKILELKKKEKL
LQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKLPQVRRRVGTAFKLDDNLLPSEE
DPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTEAVKKLQEIENAINEYR
IRCGKKPSQKATVILPEDIIPSENSSLSDTTTYDDSNDTFTLAGQRPSSVPHSPRILPPK
SLGIERIHFRKSSASEQFVETRQSREMLSTHSSPYKTLDRRPPGGRSMPTTPVLTRNAYS
SSHLEPESSAQHCRQRSGSLESQSHLLSEMDNDKPFFSLSKSQRSSSTEILDDGSSYTSQ
SSTECYCVTPVAGPYYTTQTLDTRARGRRRSKKQNVSTSNSGSMPNLAQKDSLRNGVYTK
SQEQPSSSYHIAGYTPYAECDLYYSGGYVYENDTEGQYSVNPSYRSSAHYGYECQRDYSR
SFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLRGWYQRASGQKDQGHS
PQTSFDSDRGSQRCLGFAGLQVPCSPSSRTSSYSSVSSTNASGNWRTQIAVGLSDYETPA
HSSYTSCYGNIYNPLPSPGRQYPEISHLDGTDGSRLEDSLESREQRLLWHEDSKPGTLV
Download sequence
Identical sequences G1LU62
ENSAMEP00000010610 ENSAMEP00000010610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]