SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010646 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010646
Domain Number 1 Region: 282-409
Classification Level Classification E-value
Superfamily Second domain of FERM 1.32e-31
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 411-515
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-24
Family Third domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 56-148
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 193-276
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000062
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000010646
Domain Number - Region: 26-57
Classification Level Classification E-value
Superfamily WW domain 0.000303
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010646   Gene: ENSAMEG00000010130   Transcript: ENSAMET00000011106
Sequence length 1753
Comment pep:novel scaffold:ailMel1:GL192414.1:696194:883215:-1 gene:ENSAMEG00000010130 transcript:ENSAMET00000011106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSSHRTKSSGWPPPSGTWGLNQVPPYGWEMSANRDGRDCFINHMTQGIPFDDPRLESCQ
ILPPAPRRVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMINDEPVSA
APRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIINGQV
SETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLE
QRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLYV
QSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAV
LQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATLVQ
AEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEDSLVRVELHVLDVK
PITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTGTQETGTENKGKHNLLGPD
WNCIPQMTTFIGEGEQEAQITYIDSKQKTVDISDSTLCPKEHRHLYVDSTYSADELKQPL
AQPGEAPCEADYRTLAQRSLLTLSGPETLKKVQESPRGAKVSFIFGDLALDDGMNPPTLG
YERLLEEGPELLEKQRNLYVGSANDMKGLDLAPEAESIQFVANSVYANIGDVKNFEAAEG
IEEPLLHDICYAENNDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDIIDLTSLPPPE
GDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFLDDKEPGRSLQSDEIPVSLI
DAVPTSAEGKCEKGLDNTVVSTLEALEALSVSEEQQTSDNSGVAILRAYSPESSSDSGNE
TNSSEMTESSELATAQKQSESLSRMFLATHEGYHPLAEEQTEFPTSKTPAGGLPPKSSHT
LAARPVTDLPPKVVPSKQVLHPDPMEMEPETMETKSVTDYFSKLHMGSVVYSCTSKRKSK
LADGEGKAPPNANMPGKKQPGAKTAEAEEEAKGKFGTVSSRDGQHLSTFNLERTAFRKDS
QRWYMATEGAVAEKSGLEAATGITFPRASGLGTREAEEKDEGAPDGEAGEVSPLGQRDHF
LTDVTCVSSAKDLDNPEDTDPSTCDHPSKLPEPEESVARLCDYHLAKRMSSLQSECHFSL
QSSQGSSVDAGCGTGSSTCATPVESPLCPALGKHLIPETSGKAMSYVPSEERAAGLPSHG
ATFKELHPQPEGMCPRMTVPALHTAINAEPLFGTLRDGCHRLPKIKETTASVALTEPGKE
RRGGMPSAWSQHPEADPILLPSHIPSESKVPIPNQDPNDFSQANLAYGEAVNWRPLDLRG
GSLGTPRSQRALRRSSSTLSGSVGLETFQERSKGAVSLKCPGITEAQEAGSERRAELPLG
KKLTKSFSQSSMFFSSEGKVHKRSPAAHKDSKLYRTLPLRKLEGSNWRCRGPFSYCFLNR
GQDEDGDEDEEEGEATRQVSCLFRPQMTQAMPEPISPPLAVGIQKQGGELTRGSVLKIWV
EDLTGPDDADYSNLAFDARIARINALKESMYAMPDGFLAAQNDANELLCLVRATKGKREE
SRPEAYDLTLSQYKQLLSIESRQLGSACRKLAMAEKSPEEMLLAMTSSFQVLCCLTEACM
RLVKVVNSETQRQEIVAKINEVVINYICLLKAAEAATGKTSGDPNVGLSARHSTTMAALV
STLTRSLKMLLNK
Download sequence
Identical sequences G1LU98
ENSAMEP00000010646 ENSAMEP00000010646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]