SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011130 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011130
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-19
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 285-331,509-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000908
Family Second domain of FERM 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011130
Domain Number - Region: 21-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00335
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011130   Gene: ENSAMEG00000010546   Transcript: ENSAMET00000011604
Sequence length 677
Comment pep:novel scaffold:ailMel1:GL193213.1:696856:726822:1 gene:ENSAMEG00000010546 transcript:ENSAMET00000011604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSSDFASGSWELVVRVDHPNEEEQKDVTLRVSGDLHIGGLMLKLVEQINIAQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNVKTVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKSNKEPIIEDILNLEGSPTTSGPPVSP
GLYSKTMTPTYDPVSGTPASSTMTWFSDSPLTEQNCSTLAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEEEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTNESEVDEVEAALSNLEVTLEGGKAD
NTLEDITDIPKLADNLKLFRPKKLILKAFKQYWFIFKDTSIAYFKNKELEQGEPVEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYAQWMAACILASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASNLETMDMNPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRIDAATGIP
ITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQE
Download sequence
Identical sequences D2HR92
ENSAMEP00000011130 ENSAMEP00000011130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]