SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011160 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011160
Domain Number 1 Region: 591-772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-66
Family SPRY domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-24
Family Pyrin domain, PYD 0.0022
Further Details:      
 
Domain Number 3 Region: 364-428
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011160
Domain Number - Region: 415-502
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00968
Family Apolipoprotein A-I 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011160   Gene: ENSAMEG00000010608   Transcript: ENSAMET00000011638
Sequence length 778
Comment pep:novel scaffold:ailMel1:GL193204.1:128502:140785:-1 gene:ENSAMEG00000010608 transcript:ENSAMET00000011638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTPRDHLLDSLEELVSDDFEKFKFKLQNTSLERDHFRIPRGQLQNAKPVKLASLMITS
YGEEYAVKLTLQVLRAINQNLLAEELVRAIGPEYLIQESGTDSSAMSCSSGENKPKGLRI
PDGLEGERQRQSGDGAISRPSSQYEAGRGPQKKPQGKRRDQTTSEDQDMQGKPGARSMTL
SSRRSPLYGKQQGEKGSPSGKLRRNSSSAGSLQEHASESPTGSQRVKSRISGQQRPRSLD
FTISRERELPNPETLLSQEKMRSDHPDSAATPSEVATLDIGATVAPEKGSRNPEHSMIWK
PQDGAVLPLCRAQEGDDSCRYSVASRDPKTSGIRKRSSFLSLASLQVNNPEDNKQHEGLQ
IANLSPKSLPQCERHMKQVQLLFCEDHREPICLICRLTQEHQGHWVRPIEEAALEYKEQI
QKQLEHLKELRKSGEEQRSQGDKKTANFLKQIETQKQTFRHQLEQLYHLLEQQEKLFVAS
LEDLSKTIGQVGEKYNTHVSRDIALLDKLIGELEAKQCQPEWELMKDIGVTLHRVKIVAV
PKPWDIPSDVEKKIHWIYQKSEFAEKRMKSFLEKLRSETDTFNVPELICAQAYAVDVTLD
AETAHPNLIFSNNLKSVRLGNKCDRLPDNPGRFDSCTIALGLQSFLSGRHYWEVEVGKKT
GWILGICKASASRKGSMTLSPNNGYWVVMMMKRNEYQVSTIPPTRLQIREPPRRVGIFLD
YQAGDISFYNVTYKSLIYTFTSFSSSGPLKPMFSPGTHDGGKNMDPLTICPVGDQGSP
Download sequence
Identical sequences G1LVQ9
ENSAMEP00000011160 ENSAMEP00000011160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]