SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011826 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011826
Domain Number 1 Region: 185-326
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-22
Family First domain of FERM 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011826
Domain Number - Region: 481-504
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0981
Family Probable GTPase Der, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011826   Gene: ENSAMEG00000011227   Transcript: ENSAMET00000012326
Sequence length 710
Comment pep:novel scaffold:ailMel1:GL192974.1:419518:467872:-1 gene:ENSAMEG00000011227 transcript:ENSAMET00000012326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLAVGRLPCSENCTAL
MVSHILQSELGDFHEETDKKHLAQTRYLPNQDCLESKIMHFHQKHVGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGRLRSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYRNVNGVHASEPVLDSRRRNSAVEVTFAAELERSKPEADPTLLHQSQSSSSFPFIYTD
PVFSTDPDPRDYFEERSPLSSFQPSCKFADNHRSTSSRLASKVSPARQLTYTDVPYIPCT
GQQVDIMPPQVFFYVDRPPQVPKRSPVMAEERERPDSCLEPTEMKPAKRSPRNVRMKSFQ
QECQELQEAMARTSGRSNINIDLEAEDPNLEDAFAYSIQEHTPKRSQSQSDMKTIRFPFG
SEFRPLGPCPTLSRKADLLTYMFAEQEFPTVLMDQGAAERYVTSESSDSESEILKPDYYS
LYGKGIRSPMARIRLSSGSLQLDEEDEGVSFNTPTAEDRTLLKPCNYFLA
Download sequence
Identical sequences G1LXM1
ENSAMEP00000011826 ENSAMEP00000011826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]