SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012040 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012040
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-86
Family Kelch motif 0.0000000000278
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 6.8e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012040   Gene: ENSAMEG00000011445   Transcript: ENSAMET00000012549
Sequence length 624
Comment pep:novel scaffold:ailMel1:GL192824.1:705280:710228:1 gene:ENSAMEG00000011445 transcript:ENSAMET00000012549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEPRPSGARARTRFLPLRSQRPEGAGDTVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCAELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPHFLQMQLQKCEILQSDSRCKDY
LVKIFQELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSNALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMRHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTHMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences G1LY84
ENSAMEP00000012040 XP_002921417.1.58354 ENSAMEP00000012040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]