SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012884 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012884
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 175-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000013
Family I set domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012884   Gene: ENSAMEG00000012245   Transcript: ENSAMET00000013427
Sequence length 258
Comment pep:novel scaffold:ailMel1:GL192393.1:1039011:1045119:-1 gene:ENSAMEG00000012245 transcript:ENSAMET00000013427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNAIFRALVCGEPKPKVHWQSTKGNLSNSSKYQISSFPGSKEHVLQINKLTGEDSDLYRC
TAVNVYGEATCSTRLLVIEVGFRKNRKRHKEPQEGRWKGCQDLPALLPRAPPPKKKVDME
QVWQLLMTADRKDYERICLKYGIVDYRGMLRKLKEMQKEREDKMAQYLNAVSNLRHIRVS
KEGVATFDLELDLKYAGSKIYLYKDGEMVPYGFDNQTKHCLRRLGKRYQFQIRDLQPEDA
GIYQVKVEDAEIFSTELD
Download sequence
Identical sequences G1M0M4
ENSAMEP00000012884 ENSAMEP00000012884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]