SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012975 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012975
Domain Number 1 Region: 265-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.0000000000891
Further Details:      
 
Domain Number 2 Region: 152-296
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 64-162
Classification Level Classification E-value
Superfamily SH3-domain 1.6e-22
Family SH3-domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012975   Gene: ENSAMEG00000012309   Transcript: ENSAMET00000013519
Sequence length 542
Comment pep:novel scaffold:ailMel1:GL192420.1:2529842:2547954:-1 gene:ENSAMEG00000012309 transcript:ENSAMET00000013519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRCSLEPAENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTPLP
LLREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
Download sequence
Identical sequences G1M0W5
ENSAMEP00000012975 ENSAMEP00000012975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]