SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013163 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013163
Domain Number 1 Region: 73-115
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000353
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 167-208
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000811
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Elafin-like 0.000000131
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 4 Region: 122-160
Classification Level Classification E-value
Superfamily Elafin-like 0.00000288
Family Elafin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013163   Gene: ENSAMEG00000012504   Transcript: ENSAMET00000013715
Sequence length 232
Comment pep:novel scaffold:ailMel1:GL193760.1:94010:105371:-1 gene:ENSAMEG00000012504 transcript:ENSAMET00000013715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMLSCLFLLKVLLALGSLTSWVAAGEHVKAGECPPDKNPCEELCWGDESCPAGQKCCSTG
CGRVCRGGLPQGRNGGCPRAVWKQSCFQRCLNDETCPGAKKCCTFGCTKRCVVPVSKPKL
AESGGECPADPLPCEELCDRDESCPQGHKCCSTGCGHSCRGDIKGGRGGDCPRILVGLCI
VNCMMDENCQAGEKCCKSGCGRFCVPPVLPPELATNPRWTLTSDSALEIPVP
Download sequence
Identical sequences G1M1F2
ENSAMEP00000013163 ENSAMEP00000013163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]