SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013267 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013267
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013267   Gene: ENSAMEG00000012612   Transcript: ENSAMET00000013824
Sequence length 285
Comment pep:novel scaffold:ailMel1:GL193760.1:179237:180859:-1 gene:ENSAMEG00000012612 transcript:ENSAMET00000013824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSDPVDLGAAWRSARPEPPPTRFHQVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQVFLVEIEEKELGWCGHLRLGLTALDPSTLAAVPEFSLPDLVSLGHTWVFAITRHHN
RVPREDRPEAEALAPSRPPALLVEPYLCIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNV
LPPTARRSRLGVLFCPRPDGTADMHIVINGEDMGPSARGLPAAQPLYAVVDVFASTKSVR
LVQLEYGLPSLQTLCRLVIQRSVVHRLAIDGLHLPKGLKDFCKYE
Download sequence
Identical sequences D2HZ10
XP_002928099.1.58354 ENSAMEP00000013267 ENSAMEP00000013267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]