SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013399 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013399
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-37
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-19
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013399   Gene: ENSAMEG00000012675   Transcript: ENSAMET00000013958
Sequence length 685
Comment pep:novel scaffold:ailMel1:GL192656.1:568992:805637:1 gene:ENSAMEG00000012675 transcript:ENSAMET00000013958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAAPEEFYCEVLLLNESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTTGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSMSYKHRYSGRTALQMSRDLSIQLPRPDQNVARSRSKTYPKRITQTQ
PAGSNGINRVTANIENGENEGTTKIIAPSPIKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYSSPSDRVKSPKCPSTRRRNPSWGSDDSVQPTRRRKAHNSGEDSDLKQRRRSRSRCN
TSSGSESENSNREHRKKRNRTRQENDMVDSAPQWEAVLRRQKEKNQADPNSRRSRHRSRS
RSPDIQAKEELWKHIQKELVDPSGLSEEQLREIPYTKVETQGDPIRIRHSHSPRSYRQYR
RSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQTS
TSNLAGKHTAKTVKTVQASCLKIET
Download sequence
Identical sequences D2HBD3
ENSAMEP00000013399 ENSAMEP00000013399 XP_002919217.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]