SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013671 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013671
Domain Number 1 Region: 42-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-22
Family MAM domain 0.0082
Further Details:      
 
Domain Number 2 Region: 239-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000491
Family MAM domain 0.027
Further Details:      
 
Domain Number 3 Region: 6-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013671   Gene: ENSAMEG00000012990   Transcript: ENSAMET00000014242
Sequence length 351
Comment pep:novel scaffold:ailMel1:GL193530.1:480914:543006:1 gene:ENSAMEG00000012990 transcript:ENSAMET00000014242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQQGTEGFQCGNGLSLPPDNVCDFTDQCGDKSDEQQCSNYERCDFENGLCSMTQDQSLQL
GWTKRNGMTGLSLPFYDHNGDMSAHFLSLVSKVDSTSSDLRSRVFLPTNNQHTCQVTFYY
FSSQMSGKLMAGLQTSCGGPIQHLWQNTAGLQNQWERNVMNIQSNQKFQVVFQGQIISTP
EQDEVIAIDDISFSSGCLPANDEILPCPETLNMEQEPCHRDTSLCSSDSTDEGLRLYQVC
GFEFDMCDWESETSAGQISWMRAKAREVPALQSTLQQDQSSDFSGYYLWVGAKDASTLSQ
LESRAYLNSSVCRCLGKSCHLQFFYSMENSVLRVGLYNNKVRRNLDLFQIH
Download sequence
Identical sequences G1M2W0
ENSAMEP00000013671 ENSAMEP00000013671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]