SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014263 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014263
Domain Number 1 Region: 249-518
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-80
Family Protein kinases, catalytic subunit 0.000000000176
Further Details:      
 
Domain Number 2 Region: 139-281
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-37
Family SH2 domain 0.00000296
Further Details:      
 
Domain Number 3 Region: 73-189
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-24
Family SH3-domain 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014263   Gene: ENSAMEG00000013465   Transcript: ENSAMET00000014862
Sequence length 526
Comment pep:novel scaffold:ailMel1:GL192588.1:1231478:1271421:-1 gene:ENSAMEG00000013465 transcript:ENSAMET00000014862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGRSSCEDPGCPQDEGREPRMGCMKSKFLQDRGKVSKTEPSTNPHSPVYVPDPTSTSKR
VSGGRNFTIPCVSLPAGPDDIIVIALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVNSLETEEWFFKGISRKDAERQLLAPGNVLGSFMIRDSETTKGSY
SLSVRDYDPQLRDAVKHYKIRTLDSGGFYVSPRSTFGTLQELVAHYKKGSDGLCQKLTVP
CVSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANLMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGSLLDFLKSPEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMTNPEVIRALERGYRMPRPE
HCPEELYNIMTRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences G1M4J6
ENSAMEP00000014263 ENSAMEP00000014263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]