SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014566 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014566
Domain Number 1 Region: 644-839
Classification Level Classification E-value
Superfamily Sec7 domain 3.92e-73
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 408-590,1099-1500,1658-1765
Classification Level Classification E-value
Superfamily ARM repeat 6.76e-27
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014566   Gene: ENSAMEG00000013766   Transcript: ENSAMET00000015172
Sequence length 1795
Comment pep:novel scaffold:ailMel1:GL192351.1:4372444:4461733:-1 gene:ENSAMEG00000013766 transcript:ENSAMET00000015172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRILE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELERPIPSKPQSPVIQAATVSPKFSHLKQSQAQS
KPTTPEKTDLTNGEHARSASGKVSSENGDAPRERGPSLSAQSYSTGLCVGTDDGAQEVVK
EILEDVVTSAVKEAAQKHGLTEPERVLGELECQECAVPPAADDNSQTNGIADDRQSLSSA
DNLESDAQGHQVAARFSHILQKDAFLVFRSLCKLSMKPLAEGPPDPKSHELRSKVVSLQL
LLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHL
KMQIEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIF
ERLVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTS
LGQERPTDQELGDGKGLDMARRSSVTSMESTVSSGTQMAVQDDPEQFEVIKQQKEIIEHG
IELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSTRFNKEVMYA
YVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAY
VLAYSVIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMK
ETKEHTIATKSTKQSVASEKQRRLLYNLEMEQMARTAKALMEAVSHAKAPFTSATHLDHV
RPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALAR
FSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVK
TRYLSGSGREREGSLKSHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVV
AVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQ
WSRIWHVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHI
MKKNRSPTIRDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGH
IVTTIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQE
YTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHW
WQDLFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFA
QLQWCVRQDNEQLARSGTNCLENLVISNGEKFSPDVWDETCSCMLDIFKTTIPHVLLTWR
PVGMEEDSSEKHLDMDLDRQSLSSIDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLL
IKCVVQLELIQTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIRIETEDQGMYKCMSSRH
LFRLLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMY
VDENRRDSWEEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKA
HASMYYPYLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPGTLSPVW
Download sequence
Identical sequences G1M5E8
ENSAMEP00000014566 ENSAMEP00000014566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]