SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015126 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015126
Domain Number 1 Region: 26-215
Classification Level Classification E-value
Superfamily Cupredoxins 1.15e-56
Family Multidomain cupredoxins 0.0000057
Further Details:      
 
Domain Number 2 Region: 734-913
Classification Level Classification E-value
Superfamily Cupredoxins 1.72e-49
Family Multidomain cupredoxins 0.00000272
Further Details:      
 
Domain Number 3 Region: 225-369
Classification Level Classification E-value
Superfamily Cupredoxins 3.21e-49
Family Multidomain cupredoxins 0.0000035
Further Details:      
 
Domain Number 4 Region: 380-574
Classification Level Classification E-value
Superfamily Cupredoxins 3.32e-47
Family Multidomain cupredoxins 0.00000606
Further Details:      
 
Domain Number 5 Region: 921-1066
Classification Level Classification E-value
Superfamily Cupredoxins 2.39e-45
Family Multidomain cupredoxins 0.00000371
Further Details:      
 
Domain Number 6 Region: 577-721
Classification Level Classification E-value
Superfamily Cupredoxins 1.31e-41
Family Multidomain cupredoxins 0.0000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015126   Gene: ENSAMEG00000014319   Transcript: ENSAMET00000015747
Sequence length 1161
Comment pep:novel scaffold:ailMel1:GL193768.1:85393:173406:1 gene:ENSAMEG00000014319 transcript:ENSAMET00000015747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAMEPGHLIWALLLIQTSWPSLTNGATRVYYLGIQDVQWNYAPKGRNIIMNQTLDNDTV
ASSFLKSDKNRIGSSYKKTIYKEYRDGSYMDEMVQPAWLGFLGPVLQAEVGDVILIHLKN
FATRPYTIHPHGVFYEKDSEGSLYPDGSSGQLKADDSVPPGGSHIYNWTIPEGHAPTDAD
PACLTWIYHSHVDAPRDIATGLIGPLITCKRGTLDGNSPPQRKDVDNDFFLLFSVVDENL
SWHIDENIVTYCSDPTSVDKEDEAFQESNRMHAINGFVFGNLPDLSMCAQKRVAWHLFGM
GNEVDVHTAYFHGQILTIRGHRTDVAHIFPATFVTAEMVPQEPGTWLISCQVNSHLRDGM
QALYKVNSCSMTPPMNQLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSGSDKFF
QKSSSRIGGTYWKVRYEAFQDETFQEKVQLEENKHLGILGPVIRAEVGDTIQVVFYNRAS
QPFSIQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPSHAGPTAQDPACLTW
MYFSAADPIRDTNSGLVGPLLVCKTGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQ
AAAMLDSRLLSEDVKGFQDSNQMHAINGFLFSNLPSLDMCKGDTVAWHLLGLGTETDVHG
VMFQGNTVKLQGMRKSAAMLFPHTFVMAIMQPDNSGMFEIYCQAGSHRESGMKAVYNVSQ
CPGHQANDQQRYQAARIYYIMAEEVEWDYCPDRSWELEWHNQSEKDSYGHIFLSNQNGLL
GSRYKKAVFREYTDGTFKIPRPRTGPEEHLGILGPLLRGEVGDIMTVVFKNNASRPYSVH
AHGVLESSTGWPLAAVPGEVLTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLI
GPLTICRKGTLEPYGGRNDMDREFALLFLIFDENQSWYLEENVATHGPQESGRVNLQDEA
FLESNKMHAINGKLYSNLKGLTMYQGERVAWYMLAMGQDIDLHTVHFHAESFLYRNGESY
RADVVDLFPGTFEVVEMVASNPGTWLMHCHVSDHIHAGMETLFTVLSQRGKVLLSKTVFS
YSISATILRDIGEDNVRMLGMQIPVKNIEMLASVLIVMSVILLLIALALSGVVWYQHRQR
KLRRNRRSILDDSFKLLSLKQ
Download sequence
Identical sequences G1M706
ENSAMEP00000015126 ENSAMEP00000015126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]