SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015587 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015587
Domain Number 1 Region: 277-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 2 Region: 158-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.083
Further Details:      
 
Domain Number 3 Region: 213-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015587   Gene: ENSAMEG00000014810   Transcript: ENSAMET00000016237
Sequence length 370
Comment pep:novel scaffold:ailMel1:GL192567.1:1459367:1464070:1 gene:ENSAMEG00000014810 transcript:ENSAMET00000016237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALLLLLSRATTADPCYYPGGRPRFCLPPVTRLAGMAASCPQACALSLETDLSPRA
TCNGSLTLALGGPFLLTSVSLRFCTPGSPALVLSAAWATGGPWRLLWRRPAWPGALGGPE
KVTFRTPPGPKSSVAVSHLRVELGGRXXXXXXXXRGRCQCHGHAARCAARTQPPRCRCRH
HTTGPGCESCRPSHRDWPWRPATPWHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVC
ERCRHHTAGRHCHYCQPAGFWRDPSQPITSRKACRACRCHPIGATGGVCNQTSGQCPCKL
GVTGLTCNRCGPGYQQSRSPWMPCQRIPEATTPLATTPGAYSSDPQCQNYCNVSDTRVHM
SLRRYCQQDY
Download sequence
Identical sequences G1M8B7
ENSAMEP00000015587 ENSAMEP00000015587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]