SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016737 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016737
Domain Number 1 Region: 882-1182
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000972
Further Details:      
 
Domain Number 2 Region: 215-358
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-31
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 3 Region: 106-214
Classification Level Classification E-value
Superfamily Second domain of FERM 7.46e-27
Family Second domain of FERM 0.00047
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016737   Gene: ENSAMEG00000015814   Transcript: ENSAMET00000017427
Sequence length 1186
Comment pep:novel scaffold:ailMel1:GL192797.1:1052534:1149974:-1 gene:ENSAMEG00000015814 transcript:ENSAMET00000017427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRNRYQY
YLQVKKDVLEGRLRCPLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAV
LEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFSVKDNHGNSVHLGIFFMG
IFVRNRIGRQAVIYRWNDIGNVTHNKSAILVELINKEETALFHTDDIENAKYISRLFATR
HKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSI
VHGNEEALYRNSHNSLDLNYLNGTVTNGSVCSVHSINSLSCSQTFIQASPVSSNLSIPGS
DIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVMHTDSQSQSLRNLNIINTHAYN
QPEDLVYSQPEMRERHPYTAPYGPQGGYGSKLVSPSDPINPKNSTVPSKPGASAISHTVS
TPELANMQLQGTQTYNAAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKSSPDLVTRKV
QLSVKTFQEDSSPVVHQSLQEVSEPLTAAKHRGTVNKRHSLEVMSSMVRGMEAMTLKSLN
IPMARRNTLREQGPPEEVPGSHEAHQLPHYHHKKTFSDATMLIHSSESEEEEEEEAPGSV
PRIPMLREKLGYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQVSLPPAMARARVL
RHGPAKAISVSRADQLAGAGPSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIV
EREMALRNLEKQKMASLEAQKRPLMLAALNGLSVARVPGREESRADATRVPMDERFRTLK
KKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTG
YINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSHR
YWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDHG
CPEDVQGFLSYLEEIQSVRRHTNSVLEGTRSLHPPIVVHCSAGVGRTGVVILSELMIYCL
EHNEKVEVPIMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences G1MBK9
ENSAMEP00000016737 ENSAMEP00000016737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]