SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017517 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017517
Domain Number 1 Region: 440-538
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.57e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000208
Further Details:      
 
Domain Number 2 Region: 581-655
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 649-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000911
Further Details:      
 
Domain Number 4 Region: 1053-1128
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000886
Further Details:      
 
Domain Number 5 Region: 348-435
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000413
Further Details:      
 
Domain Number 6 Region: 149-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000134
Further Details:      
 
Domain Number 7 Region: 1123-1205
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.55e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000679
Further Details:      
 
Domain Number 8 Region: 975-1051
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000967
Further Details:      
 
Domain Number 9 Region: 730-834
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.95e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 10 Region: 869-921,951-974
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 11 Region: 293-368
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 12 Region: 221-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000017517
Domain Number - Region: 101-151
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0425
Family Eukaryotic type KH-domain (KH-domain type I) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017517   Gene: ENSAMEG00000016552   Transcript: ENSAMET00000018230
Sequence length 1271
Comment pep:novel scaffold:ailMel1:GL193002.1:521202:552958:1 gene:ENSAMEG00000016552 transcript:ENSAMET00000018230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKAGPVATLNSEEESDPPTYKDAFPPLPEKSACLENA
QEPAGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICVEIMQRTGAHLEL
SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLE
LKTATKIQIPRPDDASNQIRITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFI
AGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTT
IAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEV
YAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDV
NVAQEQIEAMVKDLINRMDYVEINVDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEK
SSLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKF
PEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNII
GKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAELE
VSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPASDVEKAKKQLL
HLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPTAEDKDQDLITII
GKEDAVREAQKELEALIQNLDNVVEDCMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSF
PRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTIECAIPQKFHRSVMGPKGSRIQ
QITRDYNVQIKFPDREENPVHSVEPPVQENGDDAGDGRDAKEADPGSPRRCDIIIISGRK
EKCEAAKEALEALVPVTIEVGVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDI
IAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQ
IRLEHDVNIQFPDKDDGSQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHR
VHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEY
LVDVVDSEALQLYMKPPAHEESKAPSKGFVVRDAPWTANSSEKAPDMSSSEEFPSFGAQV
APKTLPWGPKR
Download sequence
Identical sequences G1MDT9
ENSAMEP00000017517 ENSAMEP00000017517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]