SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017884 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017884
Domain Number 1 Region: 627-926
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-81
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 38-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-72
Family Ephrin receptor ligand binding domain 0.000000281
Further Details:      
 
Domain Number 3 Region: 336-544
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-40
Family Fibronectin type III 0.0000864
Further Details:      
 
Domain Number 4 Region: 923-996
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.45e-21
Family SAM (sterile alpha motif) domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000017884
Domain Number - Region: 265-340,375-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000104
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017884   Gene: ENSAMEG00000016897   Transcript: ENSAMET00000018609
Sequence length 999
Comment pep:novel scaffold:ailMel1:GL192440.1:1552927:1564588:-1 gene:ENSAMEG00000016897 transcript:ENSAMET00000018609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEAPAPPPLSLPFSGPLPLPISPCLPYPPAKCLCLSETLMDTKWVTSELAWTSHPESGW
EEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRREVQRVYVELKFTVRDCNSIPNI
PGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFG
PLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTCI
ANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCL
PCPPNSRTSSPAASICTCHSNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEP
RDLGGRDDLLYNVICKKCHGGPGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHT
RYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLHLHSSSGSSLTLSWAPPERP
NGVILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAE
FETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAVVCLRKQRHGSDSEYAEKLQQ
YIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRRE
VFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCAL
DSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGL
SRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPY
WDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNA
ASLKVIATAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFATFDLVAQ
MTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences G1MEV5
ENSAMEP00000017884 ENSAMEP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]