SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018280 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018280
Domain Number 1 Region: 893-1105
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 1571-1810
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000033
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1097-1193
Classification Level Classification E-value
Superfamily PH domain-like 0.000000342
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018280   Gene: ENSAMEG00000017303   Transcript: ENSAMET00000019020
Sequence length 1897
Comment pep:novel scaffold:ailMel1:GL192425.1:2827647:2882307:-1 gene:ENSAMEG00000017303 transcript:ENSAMET00000019020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRQPPTPPPRTCFPLAGLRSARPLPGPGTEGRRRRQQQQQQQERAQRPADGLHSWHSFSQ
PQAGARASCSSSSSRGRAASSSEEEEEVPPPPPPGAQSPAYHGGHSSGSDEDQDGEGGHR
WGGRPGPRPGSSRVDKDCRPDSYGLSLGSMDSVGGARSPEPPKSPRASSEEGPREWGTGS
PPCGSGPQEGLRPMSDPVGGAFRVAKVSFPAYLASPAGSRGSSRYSSTETLKDEDPWASR
GSGGWGMYRSPSFGAGEGLLLRPQPRTRTKGLVGTTRALRDGGLELDKSRQQKSLSNPDI
ASETLTLLSFLRSDLSELRVRKPGGRPSDLGSGPLDGRDSPSAGGPGAQLGPTPAPAPAS
PGTRPTLKDLTATLRRAKSFTCSEKPVARRLSRTSALKPSSSELLLAGPSAEDDPLPLVV
QDQYVQEARQVFEKIQRMGAQQDDGSDVPLGIPDWAGDMTQGQRSQEELSGPESNLTDEG
IGADPEPLVSAFCSLGTTGVWRPLSSSSAQTNHHGPGAEDSLGGWALVCPDTPPTPGALR
RRRKVPPSGPGGTELSNGEAGEAYRSLSDPIPQRHRAATSEEPSGFSVDSNLLGSLSPKT
GLPAAPAVDEGLTSGHSDWSVGSAESKGYQEVIQSIVQGPGALGRVVDDRVAGKAPKKKS
LSDPSRRGELAGPGFEGPGGEPIREVEPMLPPSSSEPILAERRAEPEEPSPARGRAQSER
TLPKTPPASSTPHRDFHLDPKLADVLSPRLIRRGSKKRPARSSHQELQREQGSEDHTSSP
SRARPSSKHVRHASVPATFTPIVVPEPPASVGPPVAVPEPVGFPARAHATLQAPSLEDVT
KQYMLTLHSGEVPAPVPVDVPCLTPVAPSSAEAKPPEAARAPEEPAPASKCCSKPQVDMR
KHVTMTLLDTEQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQF
LEQVRHCVQTWHAQQKVGDLLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLK
FLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQV
AERINKGVRSAEEAERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAVGGKKDRS
LFLFTDLVVCTTLKRKSGSLRRSSMSLYTAASVIDTASKYKLLWKLPLGDADIIKGASQA
TNRENIQKAISRLDEDLTTLGQMSKLSESLGFPHQSLDEALRDLSAAMHRDLSEKQALCY
ALSFPPTKLELCTTRPEGTDSFIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKA
IPIMKTRSGMQFSCAAPTQSSCAEPMPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCS
ARILCIGAVPGLQRRGHRERPASLRSPPETALETPGPELDVEAADEEAATLAEPGPQPCL
HISIAGSGLEMAPGPAEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEE
TPSSKEATAETTSSEEEQEPGFLPLSGSFGPGGPCSTSPMDGRALRRSSRGSFTRGSLED
LLSADPEAYQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLPHAASVTCIVYLNNQVFVSL
ANGELVVYQREAGHFWDPQNFKSVTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQ
LEHTFCVGQDSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLA
GSDAIIRQHKAACLRITALLVCEELLWVGTSAGVVLTMPTSPSTVSCPRAPLSPAGLGQG
HTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPRHRGPVSARPKMLVIV
ISGGDGYEDFRLSSGGGGSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences G1MFZ8
ENSAMEP00000018280 ENSAMEP00000018280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]