SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018509 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018509
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000103
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018509   Gene: ENSAMEG00000017517   Transcript: ENSAMET00000019253
Sequence length 308
Comment pep:novel scaffold:ailMel1:GL193697.1:206784:209252:1 gene:ENSAMEG00000017517 transcript:ENSAMET00000019253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEKGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGSAFGHHPHVAHPLLLPQNGHGNSGTTASPTEPHHQGRLASAHPEAPALRAPPSGG
LGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRP
WGTEIGAF
Download sequence
Identical sequences D2HYE8
ENSAMEP00000018509 ENSAMEP00000018509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]