SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019985 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019985
Domain Number 1 Region: 340-598
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-40
Family Kelch motif 0.00097
Further Details:      
 
Domain Number 2 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 1.49e-32
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019985   Gene: ENSAMEG00000018934   Transcript: ENSAMET00000020753
Sequence length 679
Comment pep:novel scaffold:ailMel1:GL192447.1:1371750:1373789:-1 gene:ENSAMEG00000018934 transcript:ENSAMET00000020753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHLHYAVPRPRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFA
DAFDHHKLRSQAQSFIAHNFKQLSRMGSVREESLADLSLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAASKERGPSAAEVFKCVRWTHFRDEDQDYLEGLLTKPIVKKYCLDLIEGALQ
MRYGDKLYKSLVPKPDSSNSSVVPTAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSGD
IYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCR
EGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNY
LYAVNSKRMLYYDPSHNTWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWR
RISNIPLDSETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDPREDRWINIGTMLGLL
QFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDD
EVWVQVAPQRNAQDQQGSL
Download sequence
Identical sequences G1MKV0
ENSAMEP00000019985 ENSAMEP00000019985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]