SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|64658|fgenesh1_pm.9_#_31 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|64658|fgenesh1_pm.9_#_31
Domain Number 1 Region: 21-273
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-87
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000453
Further Details:      
 
Domain Number 2 Region: 364-531
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-53
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000013
Further Details:      
 
Domain Number 3 Region: 275-356
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000294
Family Rhamnogalacturonase B, RhgB, middle domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|64658|fgenesh1_pm.9_#_31
Sequence length 532
Sequence
MLATSIFAAAIGFGSLVTAQFGLTDNDDSYVVNAGSANSLVATVDKASCDVTSIVYRGAE
LQSSSKYTHIGSGLGSATVSAQTIDDQYVKVTCETDTLTHYIVVKSGEANLYMATYTSAE
PEIGELRYIARLDNSILPSSYPFGDVSTTVGSTETIEGSDVFLVDGETRSKFYSSDRFID
DHVHCVYGDDTHACFVKPALAYEAASGGPFFRDIDTNNGGDYTSLTFYMNSGHVQTEAFR
MGLHGPYALTFSRSGVPALADFDFSFFADLDIQGYVAESGRGYVSGTASGVGSDYQTVVA
WSNDEAQYWAYASTDGSFTSPAVKPGTYTMKLYQTELEVASQSVDVSAGSTTSSDIASTL
TAPTTSLWTIGSCDGQPTGFLNADKQLRMHPSDSRMSDWGPTDFVVGEANATDFPMALFK
AVNSGQNITFSLEDASSDATLRIRTTLAFASGRPQVVVNTWTADAPDAPTKIDSRGVTRG
AYRGYGEAYEVDIPSSELVAGQNSIQINVISGSSGDEFLSPNFILDCIELYR
Download sequence
Identical sequences jgi|Zasce1|64658|fgenesh1_pm.9_#_31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]