SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|65324|fgenesh1_pm.11_#_191 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|65324|fgenesh1_pm.11_#_191
Domain Number 1 Region: 130-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.78e-38
Family Hypothetical protein AT3g04780/F7O18 27 0.00029
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.76e-29
Family Thioltransferase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|65324|fgenesh1_pm.11_#_191
Sequence length 328
Sequence
MSKTVAVTSPSHFTQILQSSRIVVTDFWAEWCGPCKAIAPVYEALSSQLSRPGQITFTKV
NTDEQKDIVQTYNISAMPTFLIFKGGRETKRIRGADPKGLDAAVKQLAQEASSADEGGAG
PSDGGSSGGRWTGAAAPRGYTEVTEQVDIQGLDFLNLDGNAGDKRAVFAPEKPSSLDGKG
KASESSKKDWIESDTDEQLMLYVPFQSTLKLHSIHITSIPSGSEEAMRPKTLHLYSNRSH
VLGFDEAEDTPETQKIEIQESQWDEKTQTAKVELRFVKFQNISSLTIFVVDGDGDAEKTR
IDRLRLFGESGEKRAMGKLEKIGDEQGE
Download sequence
Identical sequences jgi|Zasce1|65324|fgenesh1_pm.11_#_191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]