SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa017082m|PACid:17640515 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa017082m|PACid:17640515
Domain Number 1 Region: 22-122
Classification Level Classification E-value
Superfamily Cupredoxins 6.88e-31
Family Plastocyanin/azurin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa017082m|PACid:17640515
Sequence length 173
Sequence
MASSQLFIILSILAIFVPSTLATDYVVGDDKGWTINFDYQAWAQGKLFYVGDNLVFNYPK
GAHTVLKVNGTGFQQCAAPLDSVPLTSGKDVINLATPGRKWYICGVGQHCEVGNQKLVIT
VLPSSSSSAPSSSPSSWPSATAGPGPSTSSATTSVGTRFALMMVTIAFAMLMA
Download sequence
Identical sequences M5WBX6
XP_007210035.1.23749 ppa017082m|PACid:17640515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]