SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa000083m|PACid:17652147 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa000083m|PACid:17652147
Domain Number 1 Region: 837-1159,1262-1306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-68
Family FAD-linked reductases, N-terminal domain 0.0000299
Further Details:      
 
Domain Number 2 Region: 1141-1252
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.75e-28
Family L-aminoacid/polyamine oxidase 0.00035
Further Details:      
 
Domain Number 3 Region: 576-672
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000215
Family SWIRM domain 0.046
Further Details:      
 
Domain Number 4 Region: 1391-1476
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000497
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa000083m|PACid:17652147
Sequence length 1883
Sequence
MDGEEKKSGFKRRSKLIEANINSDDDEPIGSLLKLKRQRNPKKVKPRLEGVSERSRKVED
EEEDLGGLDDTLASLRKKLKGPKKDSGAGTIRGRDVVQSLDRSSNGPVEDGGLDEKSVSM
VLEKGPVMVDDGSDVTIDMEVENKLKGKGKRPKVSESRGYGEGSNSSLDHHPEDSLSAIF
RKAQSGFTKKSRTSSSPKENNGSQVLEDGLNPSSEGVTGNTMPVMNNEAIVDPYGSNFQE
GPCNSDKVNDGDSKHLTHKTHTFEDGLKHCSMVDLSTLTKYDVERHNSIPCPKQMEDVHG
VGDRDSKGGFTDAFCIESKDVLDMSEDKRLVSSSHLPQNSLTFHVKMEDELDSDRCQNFS
EHTQHPLCSFASGTLKMEETHNICNGQISCTEEPGLASHSLPEEKAVIADRRLSSLDITS
SRAQKLGYANQLNHQGESFETCVHSNKSTAPIQKGSSAIRQDLSSDEASKERNGPNHDYL
IIDEEADGASPPLCTYENESCPEDTVSLPDVENKDTKLSAVQRVVRNVRKRRHGDMAYEG
DADWEVLINDQGLDSDNSFRTRVKFDSSSSIGTEAESGEAAAVSAGLKAHAVGPVEKIKF
KEILKRRGGIQDYLECRNQILALWSKDVSRILPLTDCGVTDTACAGEPPRASLIRDIYAF
LDLSGYINVGIACEKDKAEPGSKHDYKILREKNFEEISGVSVADSEDGVSFIIGQVKSSK
TSVDVKNGVLIENENVTRRATNDNGLITAVELALSNATNHVDCNSAYQENSSGDARLQNR
LDNMDFSSSDPTGDALGGGAVPVATPEMKNVSHSIQSASHDHAVRNSNPQCGPEVRMEII
VIGAGPAGLTAARHLQRQGFSVTILEARSRIGGRVYTDRSSLSVPVDLGASIITGVEADW
ATERRPDPSSLVCAQLGLELTVLNSDCPLYDITTGAKVPADLDEALEAEFNSLLDDMVLL
VAQEGEHAMRMSLEEGLEYALKRRRMAQTGTSVKEKELHEQELLSPLERRVMDWHFANLE
YGCAALLKEVSLPNWNQDDVYGGFGGAHCMIKGGYSTVVESLGEGLCIHLNHVVTDISYG
IKDAGLNTNQCNKVKVSTSNGNDFLGDAVLITVPLGCLKAETIKFSPPLPHWKHSSIQQL
GFGVLNKVVLEFPDVFWDDSVDYFGATAEETDLRGQCFMFWNIRKTVGAPVLIALLVGKA
AIDGQNMSSSDHVNHALVVLRKLFGEASVPDPVASVVTDWGRDPFSYGAYSYVAVGASGE
DYDILGKPVENCLFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILTTGNDHTAEVEAIE
AIQRQSDSERDEVRDITRRLDAVELSNVLYKNREALLQDMFFNSKTTKGRLHLVKELLSL
PVETLKSVAGTKEGLTTLNSWILDSMGKAGTQLLRHCVRLLVLVSTDLLAVRLSGIGKTV
KEKVCVHTSRDIRAIASQLVSVWLEVFRKEKASNGGLKLSRQAAAVDSFKRKPIRDPSSG
KPPLHTFHGALEHKGSLQDSASTANHLPLNAVKKVNGKAIKIEAVNSSKLEINSSRSRGS
TGRPDTKLEVNNFVMTEAERAAIAAAEAARAAALAAAEAYASSEAKSSTLLHLPKIPSFH
KFARRDQYPQIDEYDFRRKWSGGDLGRQDCISEIDSRNCKVRNWSVDFSAACVNLDSSRM
SVDNLSQRSHPNETASQLNFREHSGESAAVDSSIYTKAWVDTAGSVGIKDYHAIEMWQSQ
AAAADPDFFHPAPYINDEEDSNTTSKKLSWKHEGIVNESSVSQVTVNKESLKNHHRGADH
IKQAVVDYVASLLMPLYKAKKIDRDGYKSIMKKSATKVMEQATDAEKAMAVSGFLDFKRR
NKIRAFVDKLIERHMAVKPTVKS
Download sequence
Identical sequences M5XL79
XP_007225485.1.23749 ppa000083m|PACid:17652147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]