SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa000544m|PACid:17667853 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa000544m|PACid:17667853
Domain Number 1 Region: 945-1094
Classification Level Classification E-value
Superfamily VC0467-like 2.22e-21
Family VC0467-like 0.0028
Further Details:      
 
Domain Number 2 Region: 750-794,824-874
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000147
Family PDI-like 0.03
Further Details:      
 
Weak hits

Sequence:  ppa000544m|PACid:17667853
Domain Number - Region: 29-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0672
Family PDI-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa000544m|PACid:17667853
Sequence length 1104
Sequence
MKKLAFLGCWILLLASILAVDSKSDGLGEWHILTKQNFSSQIRLHPHILLIVTLPWSGES
QSFMKDVARLVTDRPEEFSSLKLMLMHRNTEKLLVEAIGATTDAEETTVLYYHHSVSYKY
RGRLRPQNVLSSLRPYVSIEPEELLFKSLTTPEDLKAFLDSTDKALLLFEFCEWSSKLLA
KRKMNGTDRSGFGVQGDPIGLNFSVEANRSPAHLGKNNQKGMETANMKCGVDYGLGGVPW
LGGFSSVNDSASLERSEKMSPGVASFCTRKEYQLFDSFFSKFMTVAREFFLPPERHKFGL
VSERSMLSNLGVEDSGSWLAVLYFSGCPSCSKVIKKEDDLKNALQMDNLVVTELEGDGNT
LQPAFPANQPSVLLFVDRSSELSETRIKCKEALDAFRELALHYLISQQVDGQPEDKSEMS
KVEDYHALRSKSGHPKLKLSQAAQMIKLKDKMSNFMIVNEGKQVTLDKISLDLQGSSLKE
ILDIVLKQKKKAKLSSLAKELGFQLLSDDMDIKLVNTMPVRTEVQSDQHTQELSKEATIT
SSVDSDKDQFPQGTSISAEEHLEISEVTGSEISFQNDEEKTAYVDTSKQFLSVDSEQNRA
DHKLDTAEDLKVEEEISSRVDKSGEQQLHFQGFKGSFFFSDGNDRLLHALTGGSKVPAVV
IVDPVAAQHHVLSEETNLSYSSLADFLAEFVNGSLLPYQQSESVLHRSREATQPPFVNLD
FHQVDTIPQVTSRTFSELVIGFNQSDTDAWNKDVLVLFSNRWCGFCQRMELVVHEVYRSM
KDYVKMLKSGSKNEKTMFHDGDLKDVMLKLPFIYLLDCTLNDCSLILKSMNQREVYPALV
LFPAERKNVLPYEGDMAVTEIFKFMADHGSNSHHLISEKGILWTVAKKRGRNQNFFKVQL
SDIHEEGPIEKDTLHEVLLTKTHKQVIRDDQAKSHTSQGFNEAALRVVTGSILVATDKLT
VHPFDKSEILIVKADQVTGFQGLIINKHIRWDALNELEQGLEMLAEAPLSFGGPLIKGGM
PLVALTRRFVKTEYPEVLQGVFFLDQLATIQKIKELKSGNQSVSDYWFFFGYSSWGWDQL
FDEIAEGAWNLSDDGLKHLEWPLG
Download sequence
Identical sequences M5XKK3
ppa000544m|PACid:17667853 XP_007225418.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]