SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa002048m|PACid:17661138 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002048m|PACid:17661138
Domain Number 1 Region: 257-350,402-480
Classification Level Classification E-value
Superfamily TPR-like 2.03e-29
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Domain Number 2 Region: 498-608
Classification Level Classification E-value
Superfamily TPR-like 8.22e-24
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 3 Region: 615-716
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000425
Family Thioltransferase 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa002048m|PACid:17661138
Sequence length 724
Sequence
MADMAKYKVDKDLGCGFMGGIFQCRSYWSRKSSVHSLPSNSSKNDLKAPINDDYSTKSEE
SKSQQPKSTEAAIVVSSNSGRPSPNRDSKHSRKPSLGHPRPSACHQKAQPRRHSDAGRRS
TSSSNGTSSQIKVLQIQDLSKETKLQRASTTRSAELSRKITDHQQANENKPLVRATSSNM
VLSGQLGNLRQPGVSNQAASNSPIATIKTLTYHPRNLEDSNSTPTRKFGKLGGNVVMGNI
VRKNSDEFGGLAWNKLDPEVLKSMGNEAYKQGRFEEALAFYDRAIALDSNKAAYHSNKGA
ALVGLGRLIEAVFECKEAIQIEPCYHKAHHRLATTYLRLGEAEKALDHYKHSGPYANSKD
VDQCQALQKCLSRCTEAQKLQEWNILLNETQLAISSGANSAPQVFALQAEALLKLHRHQE
AYATYQKRPSFSIDICTKFFGLASSAFLLMIGAQVYLAVGRFEDAIAAAQNAARLNPSDK
NVAAVVKRARAVASARVSGNLLFKASKFSEACVVYSQGLQHDPHNSVLLCNRAACRTKLG
QFEKAIDDCNAALNVLPSYSKARLRRADCNAKLERWGPSIQDYEVLIRETPGDEEVGKAL
FEAKIQLKTQRGEDIKDMKFGSNLVLISSNERFRHFVTSPGMSVVLFCSKTKQKQVLQAL
HQVCTRFPSVNFLKVEVEDHPYLAKMEDVSTIPAFKIYKNGSRVKEIPGSNHELLESSVK
LYSS
Download sequence
Identical sequences M5XLP7
ppa002048m|PACid:17661138 XP_007225670.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]