SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa002367m|PACid:17656202 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002367m|PACid:17656202
Domain Number 1 Region: 484-678
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.6e-29
Family Thioltransferase 0.0069
Further Details:      
 
Domain Number 2 Region: 210-303,355-436
Classification Level Classification E-value
Superfamily TPR-like 1.73e-26
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa002367m|PACid:17656202
Sequence length 680
Sequence
MSHPGKPISELGLDSLNDRFRDSLSCEANKPDFRELDLGSPVSPLRTRQSGGLATATSSS
SSSSGSFSGRNGPNPAAKRSDSAPNNHSGELSGSSESSPTAAESVRSAGNTRNFKPGHTR
SDSGSTHPLIYSGQSSVNSPPLNVLPTGNICPSGKILKTGMVPNRSSRTDVLGSGMGNYG
HGSIMRGGPAAKSGGIEAVNLLKRTMVSADPEEVKRAGNEQYRRGHFAEALSLYARAIAL
SPANPAYRSNRAAALTGLGRLVEAVRECEEAVRLDPNYGRAHQRLGSLFLRLGQVENARR
HLCFPGLKPDPAELQKLQAVEKHLKKCTDSRRVGDWKSVLRECDATIASGADFSPQLCMC
RAEALLKLHQIDDAELVLSNTPKLETKPSQSKFFGMLSEAYSYFVMAQIEMAFGRFENAV
TAAEKAGLIDPRNIEAAVLLNNVRMVVRARARGNDLFKSERFTEACSAYGDGLRFDPSNS
VLFCNRAACWFKLGMWERSIEDCNQALCIKPNYTKALLRRAASNSKLERWVDAVRDYEVL
SKELPDDNEVAESLFHAQVSLKKSRGEEVYNMKFGGEVEEILGLEQFRAAMALPGVSVVH
FKAASDFQCKQISPFVDTLCGRYPSINFLKVDIEENQAVASTENVRIVPTFKIYKNGSRV
KEMVRPSREMLEHSLRHYSF
Download sequence
Identical sequences M5WH04
ppa002367m|PACid:17656202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]