SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa002508m|PACid:17658483 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002508m|PACid:17658483
Domain Number 1 Region: 306-407
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.23e-26
Family DEP domain 0.0035
Further Details:      
 
Domain Number 2 Region: 197-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.7e-17
Family Thioltransferase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa002508m|PACid:17658483
Sequence length 664
Sequence
MDSSPKGMENNAVEKDYDDQEEQGDHFSEIEIANGRNGYLEDHDDAGSSSSMTENSDEFQ
TVSPEKSEHVKLAVDKPNTENNGGAGILRPHAHLPKPEAPPGLNSSPPASPNGDASANQK
FGVAMPAIGKLIRERSSNFSAAFVRRLSSLKDNNNDTEEDPKSNKRDVTEFNLSGLKVTV
KLKTESDDHQQQGQTLKGRISFFSRSNCRDCTAVRSFLREKGLKFVEINIDVYPNREKEL
VERTGTSSVPQIFFNEKLFGGLVALNSLRNSGGFDQRLKEMLSSKCPDDAPATPVYGFDD
PEEEWTDQMIGIVKVLRLRLPIQDRLMKMKIVKNCFAGSEMVEVLIQHLDCGRRKAVEIG
RQLARKHFIHHVFGENDFEDGNHFYRFLEHEPFIPKCFNFRGSISDTEPKSAAKVGQRLT
KIMSAILESYASDDRRHLDYIGISNSEEFRRYINLVQELHRVNLFELSPDARLSFFLNLY
NAIVIHAVIRVGRPQGVIERRSFFSEFQYLVGGHPYSLNTIENGILRNNRRPPYSLVKPF
GAGDNRTELACAKVNPLIHFGLCNGTRSGPTVRFFSPQGVEAELRFAAREFFKSGGMEVN
LEKRTVYLTQIIKWFNGDFGQEKEILKWILNYLDATRAGLLTHLLGDGGPINIVYQNYDW
SMNS
Download sequence
Identical sequences M5XX78
ppa002508m|PACid:17658483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]