SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa003374m|PACid:17666120 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003374m|PACid:17666120
Domain Number 1 Region: 31-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-28
Family Glutathione peroxidase-like 0.0003
Further Details:      
 
Domain Number 2 Region: 353-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.2e-24
Family Glutathione peroxidase-like 0.00049
Further Details:      
 
Domain Number 3 Region: 192-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.67e-19
Family Glutathione peroxidase-like 0.0011
Further Details:      
 
Domain Number 4 Region: 497-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000011
Family C1-like domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa003374m|PACid:17666120
Sequence length 580
Sequence
MSDSKQNVAELVNSEPHDFRSLLSSSERDFLVGNNGDQIKVESLKGKKLGLYFSASWCGP
CRRFTPSLVEVYNELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRVDK
LFKVRGIPHLVILDEDGKVLSDSGVEIIQEHGVDGYPFTPEKIKELNDQEEAARRDQSLK
TILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSAYSPCVDFTPKLLEVYEKLKANGE
SFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVGKLARYFELSTLPTLVIIGADGKTV
SKNVAEAIEEHGVLAYPFTPEKFEELIEIEKAKEKAQTLESILISGDRNFVIGKGGTEIP
VSDLVGKNILLYFSAHWCPPCRAFLPKLLEAYHKIKAKDDAFEVIFISSDRDQDAFDEFF
SGMPWLALPFGDSRKACLSRRFKVQGIPMLIAIGPTGQTVTKEARHLVMQHGANAYPFTE
ERLKEIEAEFEEMAKGWPEKLKSAQHEEHELVLARRKDYVCDGCDEPGEEGWSFYCEACD
FDLHPKCALEEDKGTKSDAKQEQDPPQEEWACDGDVCKKA
Download sequence
Identical sequences M5XL72
ppa003374m|PACid:17666120 XP_007225633.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]